PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000836293
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 343aa    MW: 39027.5 Da    PI: 5.1728
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000836293genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM130.11.6e-40241521128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    l pGfrF Ptde lv++yL++k++g++ ++ + i+e+d++k+eP dLp+ + + +++ +fF++ d ky++g+r nrat++g+ k tgk++e+ ++ 
  MDP0000836293  24 LLPGFRFYPTDELLVSYYLRNKIQGTDSHFRHLIPEMDVCKYEPCDLPAFFPEXHEKEWFFTRLDYKYNNGTRCNRATDQGFYKITGKEREIRAEe 119
                    579**************************9889***************7665655666699********************************985 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++++vg k+tL+fy+gr pk++ktdWv+hey l
  MDP0000836293 120 SKAVVGKKRTLTFYEGRVPKSKKTDWVVHEYYL 152
                    66779**************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-4522175IPR003441NAC domain
PROSITE profilePS5100545.84724175IPR003441NAC domain
PfamPF023657.2E-1926151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MSSGSSSSSM TTEEGDAENV NVILLPGFRF YPTDELLVSY YLRNKIQGTD SHFRHLIPEM  60
DVCKYEPCDL PAFFPEXHEK EWFFTRLDYK YNNGTRCNRA TDQGFYKITG KEREIRAEES  120
KAVVGKKRTL TFYEGRVPKS KKTDWVVHEY YLTETEVGSK PTKQKDFVLC RLKNKSASYK  180
KPKGDPIRGE LADSGASSED DQAVVSDVIA EPVEHLGNKE LGDVNSNESP DGSCLMDCND  240
IWTLADGDVE TGGWKFSDFD DPTRFLELCA EMRDILNSPS QPPQPMQTPQ PHQPPRPYQP  300
LQPPQLYQPL QPHQPQDYCP ATLQPPIKRR YRCGYLLVSP LY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-3371811171NO APICAL MERISTEM PROTEIN
1ut4_B2e-3371811171NO APICAL MERISTEM PROTEIN
1ut7_A2e-3371811171NO APICAL MERISTEM PROTEIN
1ut7_B2e-3371811171NO APICAL MERISTEM PROTEIN
4dul_A2e-3371811171NAC domain-containing protein 19
4dul_B2e-3371811171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.140820.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008359770.10.0PREDICTED: NAC domain-containing protein 72-like
TrEMBLM5X7M11e-101M5X7M1_PRUPE; Uncharacterized protein
STRINGPOPTR_0012s00760.12e-41(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13710524
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.29e-42TCV-interacting protein